PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010528596.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 334aa    MW: 37174.5 Da    PI: 7.5543
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010528596.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41e-154387147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE+ ++vda k++G   W+ I +++g ++t+ q++s+ qk+
   XP_010528596.1 43 REKWTEEEHMKFVDALKLYGRA-WRCIQEHVG-TKTAVQIRSHAQKF 87
                     789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.96E-153791IPR009057Homeodomain-like
PROSITE profilePS5129418.1373892IPR017930Myb domain
TIGRFAMsTIGR015572.6E-154190IPR006447Myb domain, plants
SMARTSM007172.2E-114290IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-84383IPR009057Homeodomain-like
PfamPF002497.4E-134386IPR001005SANT/Myb domain
CDDcd001672.06E-94588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MEIQEQCRMI HSSGENVLCD EPISCAKAFN LKARKPYTIT KQREKWTEEE HMKFVDALKL  60
YGRAWRCIQE HVGTKTAVQI RSHAQKFFTK VARDCGVTSD ESIEIPPPRP KRKPVHPYPR  120
KLILPTCKTI SEGYGSKLVS EDENQSPTSV LSALGSEPLG FTGSSSPNSS ADDHLSLVFH  180
GNESSHTEES SPESTVRTLK LFGTTVLVNG SAYDVKTLAP IHPLARKASV PAANDLESLR  240
INVDTTDFLT SRTVHREGAS STGSNDSEDT DKNLDSETQS RRCSSGNAET DETRFPEFKP  300
SERSAFSRPR PRPEMNNFIG SMPYKKRRAV EDSI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010528596.10.0PREDICTED: protein REVEILLE 2
SwissprotF4K5X62e-89RVE2_ARATH; Protein REVEILLE 2
TrEMBLA0A078HLV34e-84A0A078HLV3_BRANA; BnaA05g12950D protein
STRINGAT5G37260.15e-87(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144321922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.11e-78MYB_related family protein